LMO3 monoclonal antibody (M05), clone 2D6
  • LMO3 monoclonal antibody (M05), clone 2D6

LMO3 monoclonal antibody (M05), clone 2D6

Ref: AB-H00055885-M05
LMO3 monoclonal antibody (M05), clone 2D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LMO3.
Información adicional
Size 100 ug
Gene Name LMO3
Gene Alias DAT1|MGC26081|RBTN3|RBTNL2|RHOM3|Rhom-3
Gene Description LIM domain only 3 (rhombotin-like 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55885
Clone Number 2D6
Iso type IgG2b Kappa

Enviar un mensaje


LMO3 monoclonal antibody (M05), clone 2D6

LMO3 monoclonal antibody (M05), clone 2D6