PBK monoclonal antibody (M11), clone 3A11
  • PBK monoclonal antibody (M11), clone 3A11

PBK monoclonal antibody (M11), clone 3A11

Ref: AB-H00055872-M11
PBK monoclonal antibody (M11), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PBK.
Información adicional
Size 100 ug
Gene Name PBK
Gene Alias FLJ14385|Nori-3|SPK|TOPK
Gene Description PDZ binding kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55872
Clone Number 3A11
Iso type IgG2a Kappa

Enviar un mensaje


PBK monoclonal antibody (M11), clone 3A11

PBK monoclonal antibody (M11), clone 3A11