PSENEN monoclonal antibody (M01), clone 1C12-G5
  • PSENEN monoclonal antibody (M01), clone 1C12-G5

PSENEN monoclonal antibody (M01), clone 1C12-G5

Ref: AB-H00055851-M01
PSENEN monoclonal antibody (M01), clone 1C12-G5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSENEN.
Información adicional
Size 100 ug
Gene Name PSENEN
Gene Alias MDS033|MSTP064|PEN-2|PEN2
Gene Description presenilin enhancer 2 homolog (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSENEN (AAH09575, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55851
Clone Number 1C12-G5
Iso type IgG1 kappa

Enviar un mensaje


PSENEN monoclonal antibody (M01), clone 1C12-G5

PSENEN monoclonal antibody (M01), clone 1C12-G5