MDS032 MaxPab mouse polyclonal antibody (B01P)
  • MDS032 MaxPab mouse polyclonal antibody (B01P)

MDS032 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055850-B01P
MDS032 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MDS032 protein.
Información adicional
Size 50 ug
Gene Name USE1
Gene Alias MDS032|P31|SLT1
Gene Description unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDS032 (NP_060937, 1 a.a. ~ 259 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55850

Enviar un mensaje


MDS032 MaxPab mouse polyclonal antibody (B01P)

MDS032 MaxPab mouse polyclonal antibody (B01P)