CENPN MaxPab rabbit polyclonal antibody (D01)
  • CENPN MaxPab rabbit polyclonal antibody (D01)

CENPN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055839-D01
CENPN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CENPN protein.
Información adicional
Size 100 uL
Gene Name CENPN
Gene Alias BM039|C16orf60|CENP-N|FLJ13607|FLJ22660
Gene Description centromere protein N
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CENPN (NP_060925.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55839

Enviar un mensaje


CENPN MaxPab rabbit polyclonal antibody (D01)

CENPN MaxPab rabbit polyclonal antibody (D01)