CAND1 monoclonal antibody (M05), clone 1G5
  • CAND1 monoclonal antibody (M05), clone 1G5

CAND1 monoclonal antibody (M05), clone 1G5

Ref: AB-H00055832-M05
CAND1 monoclonal antibody (M05), clone 1G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAND1.
Información adicional
Size 100 ug
Gene Name CAND1
Gene Alias DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A
Gene Description cullin-associated and neddylation-dissociated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55832
Clone Number 1G5
Iso type IgG3 Kappa

Enviar un mensaje


CAND1 monoclonal antibody (M05), clone 1G5

CAND1 monoclonal antibody (M05), clone 1G5