SELS purified MaxPab rabbit polyclonal antibody (D01P)
  • SELS purified MaxPab rabbit polyclonal antibody (D01P)

SELS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055829-D01P
SELS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SELS protein.
Información adicional
Size 100 ug
Gene Name SELS
Gene Alias AD-015|ADO15|MGC104346|MGC2553|SBBI8|SEPS1|VIMP
Gene Description selenoprotein S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SELS (NP_060915.2, 1 a.a. ~ 187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55829

Enviar un mensaje


SELS purified MaxPab rabbit polyclonal antibody (D01P)

SELS purified MaxPab rabbit polyclonal antibody (D01P)