ALLC purified MaxPab rabbit polyclonal antibody (D01P)
  • ALLC purified MaxPab rabbit polyclonal antibody (D01P)

ALLC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055821-D01P
ALLC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ALLC protein.
Información adicional
Size 100 ug
Gene Name ALLC
Gene Alias ALC
Gene Description allantoicase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MADAPKEGRLTRFLDFTQLMDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGIRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALLC (AAH29652.1, 1 a.a. ~ 409 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55821

Enviar un mensaje


ALLC purified MaxPab rabbit polyclonal antibody (D01P)

ALLC purified MaxPab rabbit polyclonal antibody (D01P)