ST6GALNAC1 polyclonal antibody (A01)
  • ST6GALNAC1 polyclonal antibody (A01)

ST6GALNAC1 polyclonal antibody (A01)

Ref: AB-H00055808-A01
ST6GALNAC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ST6GALNAC1.
Información adicional
Size 50 uL
Gene Name ST6GALNAC1
Gene Alias HSY11339|SIAT7A|ST6GalNAcI|STYI
Gene Description ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST6GALNAC1 (NP_060884, 43 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55808

Enviar un mensaje


ST6GALNAC1 polyclonal antibody (A01)

ST6GALNAC1 polyclonal antibody (A01)