HR polyclonal antibody (A01)
  • HR polyclonal antibody (A01)

HR polyclonal antibody (A01)

Ref: AB-H00055806-A01
HR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HR.
Información adicional
Size 50 uL
Gene Name HR
Gene Alias ALUNC|AU|HSA277165
Gene Description hairless homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHFLSPETSALSAQLCHQGPSLPPDCHLLYAQMDWAVFQAVKVAVGTLQEAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HR (NP_005135, 1090 a.a. ~ 1189 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55806

Enviar un mensaje


HR polyclonal antibody (A01)

HR polyclonal antibody (A01)