DCP1A monoclonal antibody (M01), clone 2D12
  • DCP1A monoclonal antibody (M01), clone 2D12

DCP1A monoclonal antibody (M01), clone 2D12

Ref: AB-H00055802-M01
DCP1A monoclonal antibody (M01), clone 2D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DCP1A.
Información adicional
Size 100 ug
Gene Name DCP1A
Gene Alias FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
Gene Description DCP1 decapping enzyme homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55802
Clone Number 2D12
Iso type IgG1 Kappa

Enviar un mensaje


DCP1A monoclonal antibody (M01), clone 2D12

DCP1A monoclonal antibody (M01), clone 2D12