PCID2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PCID2 purified MaxPab rabbit polyclonal antibody (D01P)

PCID2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055795-D01P
PCID2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PCID2 protein.
Información adicional
Size 100 ug
Gene Name PCID2
Gene Alias DKFZp686C20226|F10|FLJ11305|FLJ99362|MGC16774
Gene Description PCI domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MRLTDVVQQLVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGDHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCID2 (AAH31246.1, 1 a.a. ~ 397 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55795

Enviar un mensaje


PCID2 purified MaxPab rabbit polyclonal antibody (D01P)

PCID2 purified MaxPab rabbit polyclonal antibody (D01P)