DEPDC1B monoclonal antibody (M01), clone 2H2
  • DEPDC1B monoclonal antibody (M01), clone 2H2

DEPDC1B monoclonal antibody (M01), clone 2H2

Ref: AB-H00055789-M01
DEPDC1B monoclonal antibody (M01), clone 2H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DEPDC1B.
Información adicional
Size 100 ug
Gene Name DEPDC1B
Gene Alias BRCC3|FLJ11252|XTP1
Gene Description DEP domain containing 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DEPDC1B (NP_060839.1, 430 a.a. ~ 529 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55789
Clone Number 2H2
Iso type IgG2b Kappa

Enviar un mensaje


DEPDC1B monoclonal antibody (M01), clone 2H2

DEPDC1B monoclonal antibody (M01), clone 2H2