AB-H00055786-B01P
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 50 ug |
Gene Name | ZNF415 |
Gene Alias | FLJ11191 |
Gene Description | zinc finger protein 415 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr,IF |
Immunogen Prot. Seq | MWEHRKEPWTIESQVRVARKPKGWEWIKGVKTDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKKIHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMTVRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTG |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | ZNF415 (AAH69668.1, 1 a.a. ~ 542 a.a) full-length human protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 55786 |