MBD5 purified MaxPab rabbit polyclonal antibody (D01P)
  • MBD5 purified MaxPab rabbit polyclonal antibody (D01P)

MBD5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055777-D01P
MBD5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MBD5 protein.
Información adicional
Size 100 ug
Gene Name MBD5
Gene Alias FLJ11113|FLJ30517|KIAA1461|MRD1
Gene Description methyl-CpG binding domain protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MBD5 (AAH14534.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55777

Enviar un mensaje


MBD5 purified MaxPab rabbit polyclonal antibody (D01P)

MBD5 purified MaxPab rabbit polyclonal antibody (D01P)