TDP1 monoclonal antibody (M01), clone 2A10-G2
  • TDP1 monoclonal antibody (M01), clone 2A10-G2

TDP1 monoclonal antibody (M01), clone 2A10-G2

Ref: AB-H00055775-M01
TDP1 monoclonal antibody (M01), clone 2A10-G2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TDP1.
Información adicional
Size 100 ug
Gene Name TDP1
Gene Alias FLJ11090|MGC104252
Gene Description tyrosyl-DNA phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TDP1 (AAH15474.1, 1 a.a. ~ 608 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55775
Clone Number 2A10-G2
Iso type IgG1 kappa

Enviar un mensaje


TDP1 monoclonal antibody (M01), clone 2A10-G2

TDP1 monoclonal antibody (M01), clone 2A10-G2