TDP1 MaxPab rabbit polyclonal antibody (D01)
  • TDP1 MaxPab rabbit polyclonal antibody (D01)

TDP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055775-D01
TDP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TDP1 protein.
Información adicional
Size 100 uL
Gene Name TDP1
Gene Alias FLJ11090|MGC104252
Gene Description tyrosyl-DNA phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TDP1 (NP_001008744.1, 1 a.a. ~ 608 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55775

Enviar un mensaje


TDP1 MaxPab rabbit polyclonal antibody (D01)

TDP1 MaxPab rabbit polyclonal antibody (D01)