IFT122 polyclonal antibody (A01)
  • IFT122 polyclonal antibody (A01)

IFT122 polyclonal antibody (A01)

Ref: AB-H00055764-A01
IFT122 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFT122.
Información adicional
Size 50 uL
Gene Name IFT122
Gene Alias SPG|WDR10|WDR10p|WDR140
Gene Description intraflagellar transport 122 homolog (Chlamydomonas)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFT122 (NP_443711, 1194 a.a. ~ 1291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55764

Enviar un mensaje


IFT122 polyclonal antibody (A01)

IFT122 polyclonal antibody (A01)