UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055757-D01P
UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UGCGL2 protein.
Información adicional
Size 100 ug
Gene Name UGCGL2
Gene Alias FLJ10873|FLJ11485|HUGT2|MGC117360|MGC150689|MGC87276
Gene Description UDP-glucose ceramide glucosyltransferase-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UGCGL2 (AAH32302.1, 1 a.a. ~ 278 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55757

Enviar un mensaje


UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)