CNDP2 polyclonal antibody (A01)
  • CNDP2 polyclonal antibody (A01)

CNDP2 polyclonal antibody (A01)

Ref: AB-H00055748-A01
CNDP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNDP2.
Información adicional
Size 50 uL
Gene Name CNDP2
Gene Alias CN2|CPGL|FLJ10830|HsT2298|PEPA
Gene Description CNDP dipeptidase 2 (metallopeptidase M20 family)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNDP2 (NP_060705, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55748

Enviar un mensaje


CNDP2 polyclonal antibody (A01)

CNDP2 polyclonal antibody (A01)