NUP133 monoclonal antibody (M01A), clone 3E8
  • NUP133 monoclonal antibody (M01A), clone 3E8

NUP133 monoclonal antibody (M01A), clone 3E8

Ref: AB-H00055746-M01A
NUP133 monoclonal antibody (M01A), clone 3E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUP133.
Información adicional
Size 200 uL
Gene Name NUP133
Gene Alias FLJ10814|MGC21133|hNUP133
Gene Description nucleoporin 133kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 55746
Clone Number 3E8
Iso type IgG2a Kappa

Enviar un mensaje


NUP133 monoclonal antibody (M01A), clone 3E8

NUP133 monoclonal antibody (M01A), clone 3E8