N4BP2 monoclonal antibody (M01), clone 2H5
  • N4BP2 monoclonal antibody (M01), clone 2H5

N4BP2 monoclonal antibody (M01), clone 2H5

Ref: AB-H00055728-M01
N4BP2 monoclonal antibody (M01), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant N4BP2.
Información adicional
Size 100 ug
Gene Name N4BP2
Gene Alias B3BP|FLJ10680|KIAA1413
Gene Description NEDD4 binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen N4BP2 (NP_060647, 1671 a.a. ~ 1770 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55728
Clone Number 2H5
Iso type IgG2b Kappa

Enviar un mensaje


N4BP2 monoclonal antibody (M01), clone 2H5

N4BP2 monoclonal antibody (M01), clone 2H5