NECAP2 purified MaxPab mouse polyclonal antibody (B01P)
  • NECAP2 purified MaxPab mouse polyclonal antibody (B01P)

NECAP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055707-B01P
NECAP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NECAP2 protein.
Información adicional
Size 50 ug
Gene Name NECAP2
Gene Alias FLJ10420|RP4-798A10.1
Gene Description NECAP endocytosis associated 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NECAP2 (NP_060560, 1 a.a. ~ 263 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55707

Enviar un mensaje


NECAP2 purified MaxPab mouse polyclonal antibody (B01P)

NECAP2 purified MaxPab mouse polyclonal antibody (B01P)