POLR3B monoclonal antibody (M01), clone 3G10
  • POLR3B monoclonal antibody (M01), clone 3G10

POLR3B monoclonal antibody (M01), clone 3G10

Ref: AB-H00055703-M01
POLR3B monoclonal antibody (M01), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POLR3B.
Información adicional
Size 100 ug
Gene Name POLR3B
Gene Alias FLJ10388|RPC2
Gene Description polymerase (RNA) III (DNA directed) polypeptide B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLR3B (NP_060552.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55703
Clone Number 3G10
Iso type IgG2a Kappa

Enviar un mensaje


POLR3B monoclonal antibody (M01), clone 3G10

POLR3B monoclonal antibody (M01), clone 3G10