VAC14 purified MaxPab mouse polyclonal antibody (B01P)
  • VAC14 purified MaxPab mouse polyclonal antibody (B01P)

VAC14 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055697-B01P
VAC14 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VAC14 protein.
Información adicional
Size 50 ug
Gene Name VAC14
Gene Alias ArPIKfyve|FLJ10305|FLJ36622|FLJ46582|MGC149815|MGC149816|TAX1BP2|TRX
Gene Description Vac14 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEFALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNIVKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVSFIPLLRERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVLGEFLKEIKKNPSSVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VAC14 (NP_060522.3, 1 a.a. ~ 782 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55697

Enviar un mensaje


VAC14 purified MaxPab mouse polyclonal antibody (B01P)

VAC14 purified MaxPab mouse polyclonal antibody (B01P)