LUC7L monoclonal antibody (M05), clone 2D10
  • LUC7L monoclonal antibody (M05), clone 2D10

LUC7L monoclonal antibody (M05), clone 2D10

Ref: AB-H00055692-M05
LUC7L monoclonal antibody (M05), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LUC7L.
Información adicional
Size 100 ug
Gene Name LUC7L
Gene Alias FLJ10231|LUC7-LIKE|LUC7B1|SR+89
Gene Description LUC7-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,ELISA,IF
Immunogen Prot. Seq MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LUC7L (NP_060502, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55692
Clone Number 2D10
Iso type IgG1 Kappa

Enviar un mensaje


LUC7L monoclonal antibody (M05), clone 2D10

LUC7L monoclonal antibody (M05), clone 2D10