TRMU purified MaxPab mouse polyclonal antibody (B01P)
  • TRMU purified MaxPab mouse polyclonal antibody (B01P)

TRMU purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055687-B01P
TRMU purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRMU protein.
Información adicional
Size 50 ug
Gene Name TRMU
Gene Alias MGC99627|MTO2|MTU1|TRMT|TRMT1|TRNT1
Gene Description tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKKSLSRSTLRSPNGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVCCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRMU (AAH80631.1, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55687

Enviar un mensaje


TRMU purified MaxPab mouse polyclonal antibody (B01P)

TRMU purified MaxPab mouse polyclonal antibody (B01P)