DSU monoclonal antibody (M02), clone 1A7
  • DSU monoclonal antibody (M02), clone 1A7

DSU monoclonal antibody (M02), clone 1A7

Ref: AB-H00055686-M02
DSU monoclonal antibody (M02), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DSU.
Información adicional
Size 100 ug
Gene Name MREG
Gene Alias DSU|FLJ10116|MGC90296|WDT2
Gene Description melanoregulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSU (AAH32747, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55686
Clone Number 1A7
Iso type IgG2b Kappa

Enviar un mensaje


DSU monoclonal antibody (M02), clone 1A7

DSU monoclonal antibody (M02), clone 1A7