SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)

SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055681-D01P
SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCYL2 protein.
Información adicional
Size 100 ug
Gene Name SCYL2
Gene Alias CVAK104|FLJ10074|KIAA1360
Gene Description SCY1-like 2 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCYL2 (NP_060458.3, 1 a.a. ~ 929 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55681

Enviar un mensaje


SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)

SCYL2 purified MaxPab rabbit polyclonal antibody (D01P)