NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)

NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055666-D01P
NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NPLOC4 protein.
Información adicional
Size 100 ug
Gene Name NPLOC4
Gene Alias FLJ20657|FLJ23742|KIAA1499|NPL4
Gene Description nuclear protein localization 4 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPLOC4 (AAH25930.1, 1 a.a. ~ 608 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55666

Enviar un mensaje


NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)

NPLOC4 purified MaxPab rabbit polyclonal antibody (D01P)