NLRP2 purified MaxPab mouse polyclonal antibody (B01P)
  • NLRP2 purified MaxPab mouse polyclonal antibody (B01P)

NLRP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055655-B01P
NLRP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NLRP2 protein.
Información adicional
Size 50 ug
Gene Name NLRP2
Gene Alias CLR19.9|FLJ20510|NALP2|NBS1|PAN1|PYPAF2
Gene Description NLR family, pyrin domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NLRP2 (NP_060322.1, 1 a.a. ~ 1062 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55655

Enviar un mensaje


NLRP2 purified MaxPab mouse polyclonal antibody (B01P)

NLRP2 purified MaxPab mouse polyclonal antibody (B01P)