RAB20 purified MaxPab mouse polyclonal antibody (B01P)
  • RAB20 purified MaxPab mouse polyclonal antibody (B01P)

RAB20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055647-B01P
RAB20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB20 protein.
Información adicional
Size 50 ug
Gene Name RAB20
Gene Alias FLJ20429
Gene Description RAB20, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB20 (NP_060287.1, 1 a.a. ~ 234 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55647

Enviar un mensaje


RAB20 purified MaxPab mouse polyclonal antibody (B01P)

RAB20 purified MaxPab mouse polyclonal antibody (B01P)