BTBD2 polyclonal antibody (A01)
  • BTBD2 polyclonal antibody (A01)

BTBD2 polyclonal antibody (A01)

Ref: AB-H00055643-A01
BTBD2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BTBD2.
Información adicional
Size 50 uL
Gene Name BTBD2
Gene Alias -
Gene Description BTB (POZ) domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTBD2 (NP_060267, 422 a.a. ~ 503 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55643

Enviar un mensaje


BTBD2 polyclonal antibody (A01)

BTBD2 polyclonal antibody (A01)