ZNF673 monoclonal antibody (M03), clone 7D3
  • ZNF673 monoclonal antibody (M03), clone 7D3

ZNF673 monoclonal antibody (M03), clone 7D3

Ref: AB-H00055634-M03
ZNF673 monoclonal antibody (M03), clone 7D3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZNF673.
Información adicional
Size 100 ug
Gene Name ZNF673
Gene Alias FLJ20344
Gene Description zinc finger family member 673
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPDVSIFASCILKCCY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF673 (AAH12569.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55634
Clone Number 7D3
Iso type IgG2a Kappa

Enviar un mensaje


ZNF673 monoclonal antibody (M03), clone 7D3

ZNF673 monoclonal antibody (M03), clone 7D3