THUMPD1 monoclonal antibody (M01), clone 4A11
  • THUMPD1 monoclonal antibody (M01), clone 4A11

THUMPD1 monoclonal antibody (M01), clone 4A11

Ref: AB-H00055623-M01
THUMPD1 monoclonal antibody (M01), clone 4A11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant THUMPD1.
Información adicional
Size 100 ug
Gene Name THUMPD1
Gene Alias DKFZp686C1054
Gene Description THUMP domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGDDMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNREEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THUMPD1 (AAH00448, 1 a.a. ~ 353 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55623
Clone Number 4A11
Iso type IgG1 Kappa

Enviar un mensaje


THUMPD1 monoclonal antibody (M01), clone 4A11

THUMPD1 monoclonal antibody (M01), clone 4A11