STAP2 monoclonal antibody (M03), clone 6C7
  • STAP2 monoclonal antibody (M03), clone 6C7

STAP2 monoclonal antibody (M03), clone 6C7

Ref: AB-H00055620-M03
STAP2 monoclonal antibody (M03), clone 6C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAP2.
Información adicional
Size 100 ug
Gene Name STAP2
Gene Alias BKS|FLJ20234
Gene Description signal transducing adaptor family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAP2 (AAH00795, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55620
Clone Number 6C7
Iso type IgG2a Kappa

Enviar un mensaje


STAP2 monoclonal antibody (M03), clone 6C7

STAP2 monoclonal antibody (M03), clone 6C7