FLJ20097 polyclonal antibody (A01)
  • FLJ20097 polyclonal antibody (A01)

FLJ20097 polyclonal antibody (A01)

Ref: AB-H00055610-A01
FLJ20097 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FLJ20097.
Información adicional
Size 50 uL
Gene Name CCDC132
Gene Alias FLJ20097|FLJ23581|KIAA1861|MGC176659
Gene Description coiled-coil domain containing 132
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55610

Enviar un mensaje


FLJ20097 polyclonal antibody (A01)

FLJ20097 polyclonal antibody (A01)