CDKN2AIP MaxPab rabbit polyclonal antibody (D01)
  • CDKN2AIP MaxPab rabbit polyclonal antibody (D01)

CDKN2AIP MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055602-D01
CDKN2AIP MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDKN2AIP protein.
Información adicional
Size 100 uL
Gene Name CDKN2AIP
Gene Alias CARF|FLJ20036
Gene Description CDKN2A interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHGSSFVSLLKSSVNSHM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDKN2AIP (AAH22270.1, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55602

Enviar un mensaje


CDKN2AIP MaxPab rabbit polyclonal antibody (D01)

CDKN2AIP MaxPab rabbit polyclonal antibody (D01)