CHRNA9 monoclonal antibody (M01), clone 8E4
  • CHRNA9 monoclonal antibody (M01), clone 8E4

CHRNA9 monoclonal antibody (M01), clone 8E4

Ref: AB-H00055584-M01
CHRNA9 monoclonal antibody (M01), clone 8E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHRNA9.
Información adicional
Size 100 ug
Gene Name CHRNA9
Gene Alias HSA243342|MGC142109|MGC142135|NACHRA9
Gene Description cholinergic receptor, nicotinic, alpha 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHRNA9 (NP_060051.2, 139 a.a. ~ 221 a.a) partial recombinant protein with GST-pstS1 tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55584
Clone Number 8E4
Iso type IgG2a Kappa

Enviar un mensaje


CHRNA9 monoclonal antibody (M01), clone 8E4

CHRNA9 monoclonal antibody (M01), clone 8E4