NAGK polyclonal antibody (A01)
  • NAGK polyclonal antibody (A01)

NAGK polyclonal antibody (A01)

Ref: AB-H00055577-A01
NAGK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NAGK.
Información adicional
Size 50 uL
Gene Name NAGK
Gene Alias GNK|HSA242910
Gene Description N-acetylglucosamine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAGK (NP_060037, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55577

Enviar un mensaje


NAGK polyclonal antibody (A01)

NAGK polyclonal antibody (A01)