SOX6 purified MaxPab mouse polyclonal antibody (B01P)
  • SOX6 purified MaxPab mouse polyclonal antibody (B01P)

SOX6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055553-B01P
SOX6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SOX6 protein.
Información adicional
Size 50 ug
Gene Name SOX6
Gene Alias HSSOX6
Gene Description SRY (sex determining region Y)-box 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOX6 (AAH47064.2, 1 a.a. ~ 828 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55553

Enviar un mensaje


SOX6 purified MaxPab mouse polyclonal antibody (B01P)

SOX6 purified MaxPab mouse polyclonal antibody (B01P)