SOX6 polyclonal antibody (A01)
  • SOX6 polyclonal antibody (A01)

SOX6 polyclonal antibody (A01)

Ref: AB-H00055553-A01
SOX6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX6.
Información adicional
Size 50 uL
Gene Name SOX6
Gene Alias HSSOX6
Gene Description SRY (sex determining region Y)-box 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX6 (NP_201583, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55553

Enviar un mensaje


SOX6 polyclonal antibody (A01)

SOX6 polyclonal antibody (A01)