RBM38 purified MaxPab mouse polyclonal antibody (B02P)
  • RBM38 purified MaxPab mouse polyclonal antibody (B02P)

RBM38 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00055544-B02P
RBM38 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RBM38 protein.
Información adicional
Size 50 ug
Gene Name RBM38
Gene Alias HSRNASEB|RNPC1|SEB4B|SEB4D|dJ800J21.2
Gene Description RNA binding motif protein 38
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RBM38 (NP_059965.2, 1 a.a. ~ 239 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55544

Enviar un mensaje


RBM38 purified MaxPab mouse polyclonal antibody (B02P)

RBM38 purified MaxPab mouse polyclonal antibody (B02P)