IL17RB polyclonal antibody (A01)
  • IL17RB polyclonal antibody (A01)

IL17RB polyclonal antibody (A01)

Ref: AB-H00055540-A01
IL17RB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL17RB.
Información adicional
Size 50 uL
Gene Name IL17RB
Gene Alias CRL4|EVI27|IL17BR|IL17RH1|MGC5245
Gene Description interleukin 17 receptor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL17RB (NP_061195, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55540

Enviar un mensaje


IL17RB polyclonal antibody (A01)

IL17RB polyclonal antibody (A01)