FEM1A purified MaxPab rabbit polyclonal antibody (D01P)
  • FEM1A purified MaxPab rabbit polyclonal antibody (D01P)

FEM1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055527-D01P
FEM1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FEM1A protein.
Información adicional
Size 100 ug
Gene Name FEM1A
Gene Alias DKFZp762M136|EPRAP
Gene Description fem-1 homolog a (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQPGLPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FEM1A (NP_061178.1, 1 a.a. ~ 669 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55527

Enviar un mensaje


FEM1A purified MaxPab rabbit polyclonal antibody (D01P)

FEM1A purified MaxPab rabbit polyclonal antibody (D01P)