SMPD3 MaxPab rabbit polyclonal antibody (D01)
  • SMPD3 MaxPab rabbit polyclonal antibody (D01)

SMPD3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055512-D01
SMPD3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMPD3 protein.
Información adicional
Size 100 uL
Gene Name SMPD3
Gene Alias FLJ22593|MGC138443|NSMASE2
Gene Description sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCTALFTPIYLALLVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLARVNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAVPGSIKRTASVEYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGEEGGRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMPD3 (NP_061137.1, 1 a.a. ~ 655 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55512

Enviar un mensaje


SMPD3 MaxPab rabbit polyclonal antibody (D01)

SMPD3 MaxPab rabbit polyclonal antibody (D01)