NOP10 monoclonal antibody (M01), clone 6H6
  • NOP10 monoclonal antibody (M01), clone 6H6

NOP10 monoclonal antibody (M01), clone 6H6

Ref: AB-H00055505-M01
NOP10 monoclonal antibody (M01), clone 6H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOP10.
Información adicional
Size 100 ug
Gene Name NOP10
Gene Alias MGC70651|NOLA3|NOP10P
Gene Description NOP10 ribonucleoprotein homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55505
Clone Number 6H6
Iso type IgG2a Kappa

Enviar un mensaje


NOP10 monoclonal antibody (M01), clone 6H6

NOP10 monoclonal antibody (M01), clone 6H6