TNFRSF19 monoclonal antibody (M01A), clone 2G4
  • TNFRSF19 monoclonal antibody (M01A), clone 2G4

TNFRSF19 monoclonal antibody (M01A), clone 2G4

Ref: AB-H00055504-M01A
TNFRSF19 monoclonal antibody (M01A), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNFRSF19.
Información adicional
Size 200 uL
Gene Name TNFRSF19
Gene Alias TAJ|TAJ-alpha|TRADE|TROY
Gene Description tumor necrosis factor receptor superfamily, member 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF19 (AAH47321.1, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 55504
Clone Number 2G4
Iso type IgG1 Kappa

Enviar un mensaje


TNFRSF19 monoclonal antibody (M01A), clone 2G4

TNFRSF19 monoclonal antibody (M01A), clone 2G4