TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)
  • TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055504-B01P
TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFRSF19 protein.
Información adicional
Size 50 ug
Gene Name TNFRSF19
Gene Alias TAJ|TAJ-alpha|TRADE|TROY
Gene Description tumor necrosis factor receptor superfamily, member 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF19 (NP_683760.1, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55504

Enviar un mensaje


TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF19 purified MaxPab mouse polyclonal antibody (B01P)