TNFRSF19 polyclonal antibody (A01)
  • TNFRSF19 polyclonal antibody (A01)

TNFRSF19 polyclonal antibody (A01)

Ref: AB-H00055504-A01
TNFRSF19 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFRSF19.
Información adicional
Size 50 uL
Gene Name TNFRSF19
Gene Alias TAJ|TAJ-alpha|TRADE|TROY
Gene Description tumor necrosis factor receptor superfamily, member 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF19 (NP_061117, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55504

Enviar un mensaje


TNFRSF19 polyclonal antibody (A01)

TNFRSF19 polyclonal antibody (A01)